PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA93G00103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 500aa    MW: 56026.3 Da    PI: 8.536
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA93G00103genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-174995148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l +av+ + g++W++Ia+ ++  Rt+ qc +rwqk+l
       AA93G00103 49 KGGWTPEEDETLRQAVRTYKGKSWRKIAEFFP-DRTEVQCLHRWQKVL 95
                     688*****************************.************986 PP

2Myb_DNA-binding605.3e-19101147148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde++v++v+++G+  W+ Ia+ +  gR +kqc++rw+++l
       AA93G00103 101 KGPWTQEEDEKIVELVAKYGPTKWSVIAKSLT-GRIGKQCRERWHNHL 147
                      79*****************************9.*************97 PP

3Myb_DNA-binding55.71.1e-17153196146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +WT eE++ l +a++ +G++ W+ Ia+ ++ gRt++ +k++w++
       AA93G00103 153 KEAWTSEEELALMNAHRIHGNR-WAEIAKVLP-GRTDNAIKNHWNS 196
                      579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3454495IPR017930Myb domain
SMARTSM007176.9E-164897IPR001005SANT/Myb domain
PfamPF002492.4E-164995IPR001005SANT/Myb domain
SuperFamilySSF466892.44E-1650105IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2051105IPR009057Homeodomain-like
CDDcd001671.78E-135295No hitNo description
PROSITE profilePS5129431.61996151IPR017930Myb domain
SuperFamilySSF466894.87E-3298194IPR009057Homeodomain-like
SMARTSM007179.6E-18100149IPR001005SANT/Myb domain
PfamPF002495.6E-18101147IPR001005SANT/Myb domain
CDDcd001679.56E-15103147No hitNo description
Gene3DG3DSA:1.10.10.609.2E-27106154IPR009057Homeodomain-like
PROSITE profilePS5129422.794152202IPR017930Myb domain
SMARTSM007179.8E-17152200IPR001005SANT/Myb domain
PfamPF002491.2E-15153196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-23155201IPR009057Homeodomain-like
CDDcd001673.58E-12155198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MENKQSLAAS CSSPSEASAS SAFKSPRITS PATASPAQRR TSGPIRRAKG GWTPEEDETL  60
RQAVRTYKGK SWRKIAEFFP DRTEVQCLHR WQKVLNPDLI KGPWTQEEDE KIVELVAKYG  120
PTKWSVIAKS LTGRIGKQCR ERWHNHLNPG IKKEAWTSEE ELALMNAHRI HGNRWAEIAK  180
VLPGRTDNAI KNHWNSSLKK KSDFYLATGN LPPATKNGVV VLNGIKEQPV LDSIKDPKHS  240
SSSQKRDSDS FPQTSSGTTD INKPEDDRKN SSVPLEEVVT TTSPPQLQAF HENGHGENGY  300
GENGYGTRNL GYLYYRTPME FSISSEADQR RMFGSECGCS PVTTATSSSS PVSNSFFNTP  360
PSRRDGSLPP LSPESFLREA ARTFPNTPSI FRKRRRVISV VKNDVKEAET ETEAKESVEK  420
SLNEEEGLAM VREESCEDGE NSKVIMVYNT SPPYRIRSKR TAVLKSKQLE FISEKEEEKK  480
ADDDEKKSSE DNNNDKLDQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-71482015158MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-71482015158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1391395RKRRR
2392396KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287439.10.0hypothetical protein CARUB_v10000643mg
RefseqXP_006297357.10.0hypothetical protein CARUB_v10013377mg, partial
TrEMBLR0FDT20.0R0FDT2_9BRAS; Uncharacterized protein
TrEMBLR0HXM60.0R0HXM6_9BRAS; Uncharacterized protein (Fragment)
STRINGAT3G09370.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.11e-159myb domain protein 3r-3